Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC25358
Article Name: Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25358
Supplier Catalog Number: RPC25358
Alternative Catalog Number: BIM-RPC25358-20UG,BIM-RPC25358-100UG,BIM-RPC25358-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Inter-alpha-trypsin inhibitor family heavy chain-related protein
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ITIH4. Target Synonyms: Inter-alpha-trypsin inhibitor family heavy chain-related protein. Accession Number: Q14624. Expression Region: 689~930aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 28.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Target: ITIH4