Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC25358
Artikelname: Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC25358
Hersteller Artikelnummer: RPC25358
Alternativnummer: BIM-RPC25358-20UG,BIM-RPC25358-100UG,BIM-RPC25358-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Inter-alpha-trypsin inhibitor family heavy chain-related protein
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ITIH4. Target Synonyms: Inter-alpha-trypsin inhibitor family heavy chain-related protein. Accession Number: Q14624. Expression Region: 689~930aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Target-Kategorie: ITIH4