Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1), Unconjugated, Yeast

Catalog Number: BIM-RPC25326
Article Name: Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25326
Supplier Catalog Number: RPC25326
Alternative Catalog Number: BIM-RPC25326-20UG,BIM-RPC25326-100UG,BIM-RPC25326-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Bee
Conjugation: Unconjugated
Alternative Names: 56- kDa protein 4, p56kP-4Bee-milk proteinRoyalactin
Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Apis mellifera (Honeybee). Target Name: MRJP1. Target Synonyms: 56- kDa protein 4, p56kP-4Bee-milk proteinRoyalactin. Accession Number: O18330. Expression Region: 20~432aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 48.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 48.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTS
Target: MRJP1