Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1), Unconjugated, Yeast

Artikelnummer: BIM-RPC25326
Artikelname: Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1), Unconjugated, Yeast
Artikelnummer: BIM-RPC25326
Hersteller Artikelnummer: RPC25326
Alternativnummer: BIM-RPC25326-20UG,BIM-RPC25326-100UG,BIM-RPC25326-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bee
Konjugation: Unconjugated
Alternative Synonym: 56- kDa protein 4, p56kP-4Bee-milk proteinRoyalactin
Recombinant Apis mellifera Major royal jelly protein 1 (MRJP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Apis mellifera (Honeybee). Target Name: MRJP1. Target Synonyms: 56- kDa protein 4, p56kP-4Bee-milk proteinRoyalactin. Accession Number: O18330. Expression Region: 20~432aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 48.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 48.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTS
Target-Kategorie: MRJP1