Recombinant E. coli O9:H4 Outer-membrane lipoprotein carrier protein (lolA), Unconjugated, Yeast

Catalog Number: BIM-RPC25308
Article Name: Recombinant E. coli O9:H4 Outer-membrane lipoprotein carrier protein (lolA), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25308
Supplier Catalog Number: RPC25308
Alternative Catalog Number: BIM-RPC25308-20UG,BIM-RPC25308-100UG,BIM-RPC25308-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: lolA, EcHS_A0996, Outer-membrane lipoprotein carrier protein
Recombinant E. coli O9:H4 Outer-membrane lipoprotein carrier protein (lolA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: E. coli O9:H4 (strain HS). Target Name: lolA. Target Synonyms: lolA, EcHS_A0996, Outer-membrane lipoprotein carrier protein. Accession Number: A7ZYJ5. Expression Region: 22~203aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 22.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 22.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK
Target: lolA