Recombinant E. coli O9:H4 Outer-membrane lipoprotein carrier protein (lolA), Unconjugated, Yeast

Artikelnummer: BIM-RPC25308
Artikelname: Recombinant E. coli O9:H4 Outer-membrane lipoprotein carrier protein (lolA), Unconjugated, Yeast
Artikelnummer: BIM-RPC25308
Hersteller Artikelnummer: RPC25308
Alternativnummer: BIM-RPC25308-20UG,BIM-RPC25308-100UG,BIM-RPC25308-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: lolA, EcHS_A0996, Outer-membrane lipoprotein carrier protein
Recombinant E. coli O9:H4 Outer-membrane lipoprotein carrier protein (lolA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: E. coli O9:H4 (strain HS). Target Name: lolA. Target Synonyms: lolA, EcHS_A0996, Outer-membrane lipoprotein carrier protein. Accession Number: A7ZYJ5. Expression Region: 22~203aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 22.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 22.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK
Target-Kategorie: lolA