Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2, Unconjugated, E. coli

Catalog Number: BIM-RPC22529
Article Name: Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22529
Supplier Catalog Number: RPC22529
Alternative Catalog Number: BIM-RPC22529-20UG,BIM-RPC22529-100UG,BIM-RPC22529-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Reptile
Conjugation: Unconjugated
Alternative Names: Adamalysin IIProteinase II
Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Crotalus adamanteus (Eastern diamondback rattlesnake). Target Name: Crotalus adamanteus Snake venom metalloproteinase adamalysin-2. Target Synonyms: Adamalysin IIProteinase II. Accession Number: P34179. Expression Region: 1~203aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP
Target: Crotalus adamanteus Snake venom metalloproteinase adamalysin-2