Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2, Unconjugated, E. coli

Artikelnummer: BIM-RPC22529
Artikelname: Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2, Unconjugated, E. coli
Artikelnummer: BIM-RPC22529
Hersteller Artikelnummer: RPC22529
Alternativnummer: BIM-RPC22529-20UG,BIM-RPC22529-100UG,BIM-RPC22529-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Reptile
Konjugation: Unconjugated
Alternative Synonym: Adamalysin IIProteinase II
Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Crotalus adamanteus (Eastern diamondback rattlesnake). Target Name: Crotalus adamanteus Snake venom metalloproteinase adamalysin-2. Target Synonyms: Adamalysin IIProteinase II. Accession Number: P34179. Expression Region: 1~203aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP
Target-Kategorie: Crotalus adamanteus Snake venom metalloproteinase adamalysin-2