Anti-COL17A1
Catalog Number:
ATA-HPA043673
- Images (9)
| Article Name: | Anti-COL17A1 |
| Biozol Catalog Number: | ATA-HPA043673 |
| Supplier Catalog Number: | HPA043673 |
| Alternative Catalog Number: | ATA-HPA043673-100,ATA-HPA043673-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BP180, BPAG2 |
| collagen, type XVII, alpha 1 |
| Anti-COL17A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 1308 |
| UniProt: | Q9UMD9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | COL17A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-COL17A1 antibody. Corresponding COL17A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in human cell lines A-431 and MCF-7 using Anti-COL17A1 antibody. Corresponding COL17A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line BEWO. |
|
|
HPA043673-100ul |
|
|
|
|
|
HPA043673-100ul |
|
|
HPA043673-100ul |
Product Guarantee and Expert Support
