Anti-COL17A1
Artikelnummer:
ATA-HPA043673
- Bilder (9)
| Artikelname: | Anti-COL17A1 |
| Artikelnummer: | ATA-HPA043673 |
| Hersteller Artikelnummer: | HPA043673 |
| Alternativnummer: | ATA-HPA043673-100,ATA-HPA043673-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BP180, BPAG2 |
| collagen, type XVII, alpha 1 |
| Anti-COL17A1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1308 |
| UniProt: | Q9UMD9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | COL17A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-COL17A1 antibody. Corresponding COL17A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in human cell lines A-431 and MCF-7 using Anti-COL17A1 antibody. Corresponding COL17A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line BEWO. |
|
|
HPA043673-100ul |
|
|
|
|
|
HPA043673-100ul |
|
|
HPA043673-100ul |
Produktgarantie und fachkundiger Support
