MSRB3 Antibody
Catalog Number:
ASB-ARP61892_P050
- Images (3)
| Article Name: | MSRB3 Antibody |
| Biozol Catalog Number: | ASB-ARP61892_P050 |
| Supplier Catalog Number: | ARP61892_P050 |
| Alternative Catalog Number: | ASB-ARP61892_P050-25UL,ASB-ARP61892_P050-100UL |
| Manufacturer: | Aviva |
| Host: | Rabbit |
| Category: | Proteine/Peptide |
| Application: | IHC |
| Species Reactivity: | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA |
| Alternative Names: | DFNB74 |
| The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. |
|
|
Rabbit Anti-MSRB3 antibody Catalog Number: ARP61892 Formalin Fixed Paraffin Embedded Tissue: Human Adrenal Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
Rabbit Anti-MSRB3 antibody Catalog Number: ARP61892 Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cortex Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
MSRB3 Antibody (ARP61892_P050) in Human Adrenal using Immunohistochemistry |
Product Guarantee and Expert Support
