MSRB3 Antibody
Artikelnummer:
ASB-ARP61892_P050
- Bilder (3)
| Artikelname: | MSRB3 Antibody |
| Artikelnummer: | ASB-ARP61892_P050 |
| Hersteller Artikelnummer: | ARP61892_P050 |
| Alternativnummer: | ASB-ARP61892_P050-25UL,ASB-ARP61892_P050-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Proteine/Peptide |
| Applikation: | IHC |
| Spezies Reaktivität: | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA |
| Alternative Synonym: | DFNB74 |
| The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. |
|
|
Rabbit Anti-MSRB3 antibody Catalog Number: ARP61892 Formalin Fixed Paraffin Embedded Tissue: Human Adrenal Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
Rabbit Anti-MSRB3 antibody Catalog Number: ARP61892 Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cortex Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
MSRB3 Antibody (ARP61892_P050) in Human Adrenal using Immunohistochemistry |
Produktgarantie und fachkundiger Support
