RICTOR Antibody

Catalog Number: ASB-ARP61411_P050
Article Name: RICTOR Antibody
Biozol Catalog Number: ASB-ARP61411_P050
Supplier Catalog Number: ARP61411_P050
Alternative Catalog Number: ASB-ARP61411_P050-25UL,ASB-ARP61411_P050-100UL
Manufacturer: Aviva
Host: Rabbit
Category: Proteine/Peptide
Application: IHC
Species Reactivity: Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG
Alternative Names: PIA, AVO3, hAVO3
RICTOR and MTOR (FRAP1, MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).[supplied by OMIM, Mar 2008]
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 192 kDa
NCBI: 253260
UniProt: Q6R327
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Rabbit Anti-RICTOR antibody
Catalog Number: ARP61411
Formalin Fixed Paraffin Embedded Tissue: Human Liver
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
Rabbit Anti-RICTOR antibody
Catalog Number: ARP61411
Formalin Fixed Paraffin Embedded Tissue: Human Tonsil
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
RICTOR Antibody (ARP61411_P050) in Human Liver using Immunohistochemistry


* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL