RICTOR Antibody
Artikelnummer:
ASB-ARP61411_P050
- Bilder (3)
| Artikelname: | RICTOR Antibody |
| Artikelnummer: | ASB-ARP61411_P050 |
| Hersteller Artikelnummer: | ARP61411_P050 |
| Alternativnummer: | ASB-ARP61411_P050-25UL,ASB-ARP61411_P050-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Proteine/Peptide |
| Applikation: | IHC |
| Spezies Reaktivität: | Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG |
| Alternative Synonym: | PIA, AVO3, hAVO3 |
| RICTOR and MTOR (FRAP1, MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).[supplied by OMIM, Mar 2008] |
|
|
Rabbit Anti-RICTOR antibody Catalog Number: ARP61411 Formalin Fixed Paraffin Embedded Tissue: Human Liver Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
Rabbit Anti-RICTOR antibody Catalog Number: ARP61411 Formalin Fixed Paraffin Embedded Tissue: Human Tonsil Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
RICTOR Antibody (ARP61411_P050) in Human Liver using Immunohistochemistry |
Produktgarantie und fachkundiger Support
