Anti-NOL12 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89447-100
Article Name: Anti-NOL12 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89447-100
Supplier Catalog Number: A89447-100
Alternative Catalog Number: ABC-A89447-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 1-213 of human NOL12.
Conjugation: Unconjugated
Rabbit polyclonal antibody to NOL12.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 36 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARHSGE
Target: NOL12
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000