Anti-NOL12 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89447-100
Artikelname: Anti-NOL12 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89447-100
Hersteller Artikelnummer: A89447-100
Alternativnummer: ABC-A89447-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 1-213 of human NOL12.
Konjugation: Unconjugated
Rabbit polyclonal antibody to NOL12.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 36 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARHSGE
Target-Kategorie: NOL12
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000