Anti-Lumican Antibody [ARC0637], Unconjugated, Rabbit, Monoclonal
Catalog Number:
ABC-A80621-100
| Article Name: |
Anti-Lumican Antibody [ARC0637], Unconjugated, Rabbit, Monoclonal |
| Biozol Catalog Number: |
ABC-A80621-100 |
| Supplier Catalog Number: |
A80621-100 |
| Alternative Catalog Number: |
ABC-A80621-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 212-350 of human Lumican (LUM) (P51884). |
| Conjugation: |
Unconjugated |
| Rabbit monoclonal [ARC0637] antibody to Lumican. |
| Clonality: |
Monoclonal |
| Concentration: |
Lot Specific |
| Clone Designation: |
[ARC0637] |
| Molecular Weight: |
50 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
LDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN |
| Target: |
Lumican |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:2,000, IHC: 1:50-1:200 |