Anti-Lumican Antibody [ARC0637], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A80621-100
Artikelname: Anti-Lumican Antibody [ARC0637], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A80621-100
Hersteller Artikelnummer: A80621-100
Alternativnummer: ABC-A80621-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 212-350 of human Lumican (LUM) (P51884).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0637] antibody to Lumican.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0637]
Molekulargewicht: 50 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: LDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Target-Kategorie: Lumican
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200