Anti-MTCO2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80542-100
Article Name: Anti-MTCO2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80542-100
Supplier Catalog Number: A80542-100
Alternative Catalog Number: ABC-A80542-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse MTCO2 (NP_904331.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to MTCO2.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 23 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC
Target: MTCO2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:100-1:500