Anti-MTCO2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80542-100
Artikelname: Anti-MTCO2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80542-100
Hersteller Artikelnummer: A80542-100
Alternativnummer: ABC-A80542-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse MTCO2 (NP_904331.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to MTCO2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 23 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC
Target-Kategorie: MTCO2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:100-1:500