Anti-mTOR Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80535-100
Article Name: Anti-mTOR Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80535-100
Supplier Catalog Number: A80535-100
Alternative Catalog Number: ABC-A80535-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human mTOR (NP_004949.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to mTOR.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 289 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQI
Target: mTOR
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, ICC/IF: 1:50-1:200