Anti-mTOR Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80535-100
Artikelname: Anti-mTOR Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80535-100
Hersteller Artikelnummer: A80535-100
Alternativnummer: ABC-A80535-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human mTOR (NP_004949.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to mTOR.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 289 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQI
Target-Kategorie: mTOR
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, ICC/IF: 1:50-1:200