Anti-TLR2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80531-100
Article Name: Anti-TLR2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80531-100
Supplier Catalog Number: A80531-100
Alternative Catalog Number: ABC-A80531-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human TLR2 (NP_003255.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TLR2.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 90kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: LLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTV
Target: TLR2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1000, IHC-P: 1:50-1:200, IF/ICC: 1:50-1:200, ELISA: 1 µg/ml (starting concentration)