Anti-TLR2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80531-100
Artikelname: Anti-TLR2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80531-100
Hersteller Artikelnummer: A80531-100
Alternativnummer: ABC-A80531-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human TLR2 (NP_003255.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TLR2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 90kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: LLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTV
Target-Kategorie: TLR2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1000, IHC-P: 1:50-1:200, IF/ICC: 1:50-1:200, ELISA: 1 µg/ml (starting concentration)