Anti-SIRT1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80509-100
Article Name: Anti-SIRT1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80509-100
Supplier Catalog Number: A80509-100
Alternative Catalog Number: ABC-A80509-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SIRT1 (NP_036370.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to SIRT1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 120 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: TILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
Target: SIRT1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:1,000-1:5,000, IHC: 1:50-1:200