Anti-SIRT1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80509-100
Artikelname: Anti-SIRT1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80509-100
Hersteller Artikelnummer: A80509-100
Alternativnummer: ABC-A80509-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SIRT1 (NP_036370.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SIRT1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 120 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: TILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
Target-Kategorie: SIRT1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:5,000, IHC: 1:50-1:200