Anti-MAP1LC3A Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A80492-100
Article Name: Anti-MAP1LC3A Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A80492-100
Supplier Catalog Number: A80492-100
Alternative Catalog Number: ABC-A80492-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP1LC3A (NP_115903.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to MAP1LC3A.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 18 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE
Target: MAP1LC3A
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200