Anti-MAP1LC3A Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80492-100
Artikelname: Anti-MAP1LC3A Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80492-100
Hersteller Artikelnummer: A80492-100
Alternativnummer: ABC-A80492-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP1LC3A (NP_115903.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to MAP1LC3A.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 18 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE
Target-Kategorie: MAP1LC3A
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200