Anti-eIF4G1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10162-100
Article Name: Anti-eIF4G1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10162-100
Supplier Catalog Number: A10162-100
Alternative Catalog Number: ABC-A10162-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EIF4G1 (NP_886553.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to eIF4G1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 220 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: PEELLNGAPSPPAVDLSPVSEPEEQAKEVTASMAPPTIPSATPATAPSATSPAQEEEMEEEEEEEEGEAGEAGEAESEKGGEELLPPESTPIPANLSQNLE
Target: eIF4G1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, IHC: 1:50-1:200, IP: 1:100-1:500