Anti-eIF4G1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10162-100
Artikelname: Anti-eIF4G1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10162-100
Hersteller Artikelnummer: A10162-100
Alternativnummer: ABC-A10162-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EIF4G1 (NP_886553.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to eIF4G1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 220 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: PEELLNGAPSPPAVDLSPVSEPEEQAKEVTASMAPPTIPSATPATAPSATSPAQEEEMEEEEEEEEGEAGEAGEAESEKGGEELLPPESTPIPANLSQNLE
Target-Kategorie: eIF4G1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200, IP: 1:100-1:500