Anti-c-Kit Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A10155-100
| Article Name: |
Anti-c-Kit Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A10155-100 |
| Supplier Catalog Number: |
A10155-100 |
| Alternative Catalog Number: |
ABC-A10155-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 25-295 of human CD117/c-Kit (NP_000213.1). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to c-Kit. |
| Clonality: |
Polyclonal |
| Concentration: |
Lot Specific |
| Molecular Weight: |
120 kDa / 145 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Form: |
Liquid |
| Sequence: |
SQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARV |
| Target: |
c-Kit |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:1,000-1:5,000, IHC: 1:50-1:100 |
