Anti-c-Kit Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10155-100
Artikelname: Anti-c-Kit Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10155-100
Hersteller Artikelnummer: A10155-100
Alternativnummer: ABC-A10155-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-295 of human CD117/c-Kit (NP_000213.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to c-Kit.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 120 kDa / 145 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: SQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARV
Target-Kategorie: c-Kit
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:5,000, IHC: 1:50-1:100