PP2A Catalytic alpha Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6702
Article Name: PP2A Catalytic alpha Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6702
Supplier Catalog Number: A6702
Alternative Catalog Number: ABB-A6702-20UL,ABB-A6702-100UL,ABB-A6702-500UL,ABB-A6702-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RP-C, PP2Ac, PP2CA, NEDLBA, PP2Calpha, PP2A Catalytic alpha
This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit.
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 5515
UniProt: P67775
Purity: Affinity purification
Sequence: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRN
Target: PPP2CA
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-500µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,Kinase,Serine threonine kinases,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,TGF-b-Smad Signaling Pathway,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Endocrine Metabolism,Carbohydrate metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embeddedMouse heart tissue usingPP2A Catalytic alpha Rabbit pAb(A6702) at a dilution of 1:100 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman cervical cance tissue usingPP2A Catalytic alpha Rabbit pAb(A6702) at a dilution of 1:100 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates, using PP2A Catalytic alpha Rabbit pAb (A6702) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embeddedRat colon tissue usingPP2A Catalytic alpha Rabbit pAb(A6702) at a dilution of 1:100 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of HeLa cells using PP2A Catalytic alpha Rabbit pAb (A6702) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using PP2A Catalytic alpha Rabbit pAb (A6702) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200 µg extracts of 293T cells using 3 µg PP2A Catalytic alpha antibody (A6702). Western blot was performed from the immunoprecipitate using PP2A Catalytic alpha antibody (A6702) at a dilution of 1:1000.
Immunoprecipitation analysis of 500 µg extracts of Rat brain cells using 3 µg PP2A Catalytic alpha antibody (A6702). Western blot was performed from the immunoprecipitate using PP2A Catalytic alpha antibody (A6702) at a dilution of 1:1000.