PP2A Catalytic alpha Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A6702
- Bilder (8)
| Artikelname: | PP2A Catalytic alpha Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A6702 |
| Hersteller Artikelnummer: | A6702 |
| Alternativnummer: | ABB-A6702-20UL,ABB-A6702-100UL,ABB-A6702-500UL,ABB-A6702-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, IP, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RP-C, PP2Ac, PP2CA, NEDLBA, PP2Calpha, PP2A Catalytic alpha |
| This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 36kDa |
| NCBI: | 5515 |
| UniProt: | P67775 |
| Reinheit: | Affinity purification |
| Sequenz: | MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRN |
| Target-Kategorie: | PPP2CA |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-500µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,Kinase,Serine threonine kinases,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,TGF-b-Smad Signaling Pathway,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Endocrine Metabolism,Carbohydrate metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embeddedMouse heart tissue usingPP2A Catalytic alpha Rabbit pAb(A6702) at a dilution of 1:100 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embeddedHuman cervical cance tissue usingPP2A Catalytic alpha Rabbit pAb(A6702) at a dilution of 1:100 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates, using PP2A Catalytic alpha Rabbit pAb (A6702) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
|
|
Immunohistochemistry analysis of paraffin-embeddedRat colon tissue usingPP2A Catalytic alpha Rabbit pAb(A6702) at a dilution of 1:100 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunofluorescence analysis of HeLa cells using PP2A Catalytic alpha Rabbit pAb (A6702) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of NIH/3T3 cells using PP2A Catalytic alpha Rabbit pAb (A6702) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunoprecipitation analysis of 200 µg extracts of 293T cells using 3 µg PP2A Catalytic alpha antibody (A6702). Western blot was performed from the immunoprecipitate using PP2A Catalytic alpha antibody (A6702) at a dilution of 1:1000. |
|
|
Immunoprecipitation analysis of 500 µg extracts of Rat brain cells using 3 µg PP2A Catalytic alpha antibody (A6702). Western blot was performed from the immunoprecipitate using PP2A Catalytic alpha antibody (A6702) at a dilution of 1:1000. |
Produktgarantie und fachkundiger Support
