[KD Validated] MRPL20 Rabbit mAb, Unconjugated, Monoclonal

Article Name:	[KD Validated] MRPL20 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number:	ABB-A26199
Supplier Catalog Number:	A26199
Alternative Catalog Number:	ABB-A26199-500UL,ABB-A26199-20UL,ABB-A26199-1000UL,ABB-A26199-100UL
Manufacturer:	ABclonal
Host:	Rabbit
Category:	Antikörper
Application:	ELISA, IHC-P, WB
Species Reactivity:	Human
Immunogen:	Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation:	Unconjugated
Alternative Names:	L20mt, bL20m, MRP-L20

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 21q. Alternative splicing results in multiple transcript variants encoding different isoforms.

Clonality:	Monoclonal
Molecular Weight:	17kDa
NCBI:	55052
UniProt:	Q9BYC9
Purity:	Affinity purification
Sequence:	AFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH
Target:	MRPL20

Application Dilute:

WB,1:2000 - 1:13000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.

Application Notes:

Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Tags & Cell Markers Subcellular Markers Organelles MitochondriaEpigenetics and Nuclear Signaling DNA / RNA Translation RibosomeEpigenetics and Nuclear Signaling DNA / RNA Translation Mito. TranslationMetabolism Pathways and Processes Mitochondrial Metabolism Mitochondrial translationMetabolism Pathways and Processes Mitochondrial Metabolism Mitochondrial markers. Shipping: Ice Bag

	Western blot analysis of various lysates using [KD Validated] MRPL20 Rabbit mAb (A26199) at 1:13000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30 s.
	Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KD Validated] MRPL20 Rabbit mAb (A26199) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
	Western blot analysis of lysates from wild type (WT) and MRPL20 knockdown (KD) HeLa cells using [KD Validated] MRPL20 Rabbit mAb (A26199) at 1:2000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.
	Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KD Validated] MRPL20 Rabbit mAb (A26199) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KD Validated] MRPL20 Rabbit mAb (A26199) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KD Validated] MRPL20 Rabbit mAb (A26199) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KD Validated] MRPL20 Rabbit mAb (A26199) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using [KD Validated] MRPL20 Rabbit mAb (A26199) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.