[KD Validated] MRPL20 Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A26199
Artikelname: [KD Validated] MRPL20 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A26199
Hersteller Artikelnummer: A26199
Alternativnummer: ABB-A26199-500UL,ABB-A26199-20UL,ABB-A26199-1000UL,ABB-A26199-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: L20mt, bL20m, MRP-L20
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 21q. Alternative splicing results in multiple transcript variants encoding different isoforms.
Klonalität: Monoclonal
Molekulargewicht: 17kDa
NCBI: 55052
UniProt: Q9BYC9
Reinheit: Affinity purification
Sequenz: AFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH
Target-Kategorie: MRPL20
Application Verdünnung: WB,1:2000 - 1:13000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Tags & Cell Markers Subcellular Markers Organelles MitochondriaEpigenetics and Nuclear Signaling DNA / RNA Translation RibosomeEpigenetics and Nuclear Signaling DNA / RNA Translation Mito. TranslationMetabolism Pathways and Processes Mitochondrial Metabolism Mitochondrial translationMetabolism Pathways and Processes Mitochondrial Metabolism Mitochondrial markers. Shipping: Ice Bag
Western blot analysis of various lysates using [KD Validated] MRPL20 Rabbit mAb (A26199) at 1:13000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30 s.
Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KD Validated] MRPL20 Rabbit mAb (A26199) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Western blot analysis of lysates from wild type (WT) and MRPL20 knockdown (KD) HeLa cells using [KD Validated] MRPL20 Rabbit mAb (A26199) at 1:2000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KD Validated] MRPL20 Rabbit mAb (A26199) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KD Validated] MRPL20 Rabbit mAb (A26199) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KD Validated] MRPL20 Rabbit mAb (A26199) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KD Validated] MRPL20 Rabbit mAb (A26199) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using [KD Validated] MRPL20 Rabbit mAb (A26199) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.