EAAT2 Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A25213
Article Name: EAAT2 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A25213
Supplier Catalog Number: A25213
Alternative Catalog Number: ABB-A25213-20UL,ABB-A25213-100UL,ABB-A25213-1000UL,ABB-A25213-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GLT1, HBGT, DEE41, EAAT2, GLT-1, EIEE41, EAAT2/SLC1A2
This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Improper regulation of this gene is thought to be associated with several neurological disorders. Alternatively spliced transcript variants of this gene have been identified.
Clonality: Monoclonal
Clone Designation: [ARC63682]
Molecular Weight: 62kDa
NCBI: 6506
UniProt: P43004
Purity: Affinity purification
Sequence: VDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
Target: SLC1A2
Antibody Type: Primary Antibody
Application Dilute: WB,1:9000 - 1:36000|IF-P,1:200 - 1:800|IHC-P,1:800 - 1:8000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag
Western blot analysis of lysates from Rat brain using EAAT2 Rabbit mAb (A25213) at 1:8000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using EAAT2 Rabbit mAb (A25213) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Western blot analysis of various lysates usingEAAT2 Rabbit mAb (A25213) at1:9000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):Mouse heart.
Exposure time:30s.
Immunohistochemistry analysis of paraffin-embedded Human brain tissue using EAAT2 Rabbit mAb (A25213) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using EAAT2 Rabbit mAb (A25213) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Confocal imaging ofparaffin-embedded Mouse brain tissue usingEAAT2 Rabbit mAb (A25213, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Confocal imaging of paraffin-embedded Human brain tissue using EAAT2 Rabbit mAb (A25213, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Rat brain tissue using EAAT2 Rabbit mAb (A25213, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.