EAAT2 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A25213
- Bilder (8)
| Artikelname: | EAAT2 Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A25213 |
| Hersteller Artikelnummer: | A25213 |
| Alternativnummer: | ABB-A25213-20UL,ABB-A25213-100UL,ABB-A25213-1000UL,ABB-A25213-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GLT1, HBGT, DEE41, EAAT2, GLT-1, EIEE41, EAAT2/SLC1A2 |
| This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Improper regulation of this gene is thought to be associated with several neurological disorders. Alternatively spliced transcript variants of this gene have been identified. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC63682] |
| Molekulargewicht: | 62kDa |
| NCBI: | 6506 |
| UniProt: | P43004 |
| Reinheit: | Affinity purification |
| Sequenz: | VDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK |
| Target-Kategorie: | SLC1A2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:9000 - 1:36000|IF-P,1:200 - 1:800|IHC-P,1:800 - 1:8000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat brain using EAAT2 Rabbit mAb (A25213) at 1:8000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using EAAT2 Rabbit mAb (A25213) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates usingEAAT2 Rabbit mAb (A25213) at1:9000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Negative control (NC):Mouse heart. Exposure time:30s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human brain tissue using EAAT2 Rabbit mAb (A25213) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using EAAT2 Rabbit mAb (A25213) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining. |
|
|
Confocal imaging ofparaffin-embedded Mouse brain tissue usingEAAT2 Rabbit mAb (A25213, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining. |
|
|
Confocal imaging of paraffin-embedded Human brain tissue using EAAT2 Rabbit mAb (A25213, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
|
|
Confocal imaging of paraffin-embedded Rat brain tissue using EAAT2 Rabbit mAb (A25213, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
Produktgarantie und fachkundiger Support
