Symmetric DiMethyl-Histone H3-R8 Rabbit mAb, Unconjugated

Catalog Number: ABB-A21207
Article Name: Symmetric DiMethyl-Histone H3-R8 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A21207
Supplier Catalog Number: A21207
Alternative Catalog Number: ABB-A21207-20UL,ABB-A21207-100UL,ABB-A21207-1000UL,ABB-A21207-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: DOT, ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: H3/A, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, H3C10, H3C11, H3C12, HIST1H3A, Symmetric DiMethyl-Histone H3-R8
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails, instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.
Clonality: Monoclonal
Clone Designation: [ARC53358]
Molecular Weight: 16kDa
NCBI: 8290
UniProt: Q16695
Purity: Affinity purification
Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Target: Histone H3
Antibody Type: Primary Antibody
Application Dilute: WB,1:2000 - 1:10000|DB,1:10000 - 1:120000|IHC-P,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted). ResearchArea: Protein phosphorylation,Signal Transduction,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Immunology Inflammation,NF-kB Signaling Pathway, Epigenetics & Nuclear Signaling,Epigenetic Modifications,Methylation. Shipping: Ice Bag
Dot-blot analysis of all sorts of peptides using Symmetric DiMethyl-Histone H3-R8 antibody (A21207) at 1:1000 dilution.
Immunohistochemistry analysis of paraffin-embedded Human colon using Symmetric DiMethyl-Histone H3-R8 Rabbit mAb (A21207) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates, using Symmetric DiMethyl-Histone H3-R8 Rabbit mAb (A21207) at 1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of paraffin-embedded Rat liver using Symmetric DiMethyl-Histone H3-R8 Rabbit mAb (A21207) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Symmetric DiMethyl-Histone H3-R8 Rabbit mAb (A21207) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Confocal imaging of PC-12 cells using Symmetric DiMethyl-Histone H3-R8 Rabbit mAb (A21207, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of HeLa cells using Symmetric DiMethyl-Histone H3-R8 Rabbit mAb (A21207,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of NIH/3T3 cells using Symmetric DiMethyl-Histone H3-R8 Rabbit mAb (A21207,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.