AMPKalpha1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1229
- Images (7)
| Article Name: | AMPKalpha1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1229 |
| Supplier Catalog Number: | A1229 |
| Alternative Catalog Number: | ABB-A1229-100UL,ABB-A1229-20UL,ABB-A1229-500UL,ABB-A1229-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | AMPK, AMPKa1, AMPK alpha 1, AMPKalpha1 |
| The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed. |
| Clonality: | Polyclonal |
| Molecular Weight: | 64kDa |
| NCBI: | 5562 |
| UniProt: | Q13131 |
| Purity: | Affinity purification |
| Sequence: | ETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVS |
| Target: | PRKAA1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Autophagy,Endocrine Metabolism,Mitochondrial metabolism,Lipid Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Warburg Effect,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Cardiovascular,Hypoxia,Lipids,Fatty Acids. Shipping: Ice Bag |


