AMPKalpha1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1229
- Bilder (7)
| Artikelname: | AMPKalpha1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1229 |
| Hersteller Artikelnummer: | A1229 |
| Alternativnummer: | ABB-A1229-100UL,ABB-A1229-20UL,ABB-A1229-500UL,ABB-A1229-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AMPK, AMPKa1, AMPK alpha 1, AMPKalpha1 |
| The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 64kDa |
| NCBI: | 5562 |
| UniProt: | Q13131 |
| Reinheit: | Affinity purification |
| Sequenz: | ETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVS |
| Target-Kategorie: | PRKAA1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Autophagy,Endocrine Metabolism,Mitochondrial metabolism,Lipid Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Warburg Effect,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Cardiovascular,Hypoxia,Lipids,Fatty Acids. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using AMPKalpha1 Rabbit pAb (A1229) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using AMPKalpha1 Rabbit pAb (A1229) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Western blot analysis of lysates from Rat liver, using AMPKalpha1 Rabbit pAb (A1229) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using AMPKalpha1 Rabbit pAb (A1229) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunofluorescence analysis ofHeLa cells usingAMPKalpha1 Rabbit pAb(A1229) atadilution of1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution.Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis ofMCF7 cells usingAMPKalpha1 Rabbit pAb(A1229) atadilution of1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution.Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis ofPC-12 cells usingAMPKalpha1 Rabbit pAb(A1229) atadilution of1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution.Blue: DAPI for nuclear staining. |
Produktgarantie und fachkundiger Support
