Recombinant Human Claudin-6 (CLDN6)-VLPs (Active)
Artikelnummer:
CSB-MP005508HU(A4)
- Bilder (4)
-TEM1.jpg)
| Artikelname: | Recombinant Human Claudin-6 (CLDN6)-VLPs (Active) |
| Artikelnummer: | CSB-MP005508HU(A4) |
| Hersteller Artikelnummer: | CSB-MP005508HU(A4) |
| Alternativnummer: | CSB-MP005508HU(A4)-1, CSB-MP005508HU(A4)-100, CSB-MP005508HU(A4)-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (Skullin) |
| Molekulargewicht: | 24.8 kDa |
| Tag: | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| UniProt: | P56747 |
| Puffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Quelle: | Mammalian cell |
| Expression System: | 1-220aa |
| Reinheit: | Greater than 95% as determined by SEC-HPLC. |
| Formulierung: | Lyophilized powder |
| Sequenz: | MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
|
|
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 µg/mL can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA1HU). The EC50 is 1.334-1.504 ng/mL.The VLPs (CSB-MP3838) is negative control.②Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 µg/mL can bind Anti-CLDN6 recombinant antibody(CSB-RA005508MA2HU). The EC50 is 2.920-3.812 ng/mL.The VLPs (CSB-MP3838) is negative control.3Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 µg/mL can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA3HU). The EC50 is 3.482-4.097 ng/mL.The VLPs (CSB-MP3838) is negative control.④Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 µg/mL can bind Anti-CLDN6 recombinant antibody(CSB-RA005508MA4HU). The EC50 is 2.866-3.739 ng/mL.The VLPs (CSB-MP3838) is negative control. |
|
|
|
|
|
The presence of VLP-like structures was confirmed by TEM②Human CLDN6 Monoclonal Antibody (CSB-RA005508MA1HU) captured on Protein A Chip can bind Human CLDN6 Full Length VLP Protein with an affinity constant of 6.58 nM as detected by MetaSPR Assay (WeSPRTM 200). |
|
|
CSB-MP005508HU(A4) is detected by Mouse anti-6*His monoclonal antibody. |
Produktgarantie und fachkundiger Support
