Synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to KLH
Several major families of cell adhesion molecules can be distinguished. These include the cadherins and N-CAMs, which play a crucial role in cell recognition and adhesion, while integrins are implicated in the adherence of cells to the extracellular matrix. Cadherins constitute a family of proteins, the members of which are differentially expressed in the different tissues. One of the best characterized members is E-cadherin, which is prevalent in epithelial tissues. It has been shown to play a crucial role in the process of tumor cell metastasis. NCAMs (neural cell adhesion molecules) exist in at least three forms of plasma membrane plycoproteins, which are expressed in a variety of tissues including most nerve cells. The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha- and a beta-subunit in interconnecting the cytoskeleton and the extracellular matrix. Applications: Suitable for use in Immunohistochemistry (frozen sections), Immunocytochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (frozen): 1:25 -1:200 using avidn-biotinylated HRP complex (ABC) as detection reagent. Western Blot: 1:100 - 1:1,000 Optimum dilutions to be determined by researcher. Storage and Stability: May be stored at 4C for short-term only. For long-term storage, store at -20C. Aliquots are stable for at least 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clonality:
Monoclonal
Clone Designation:
[54B3]
Isotype:
IgG1
Purity:
Purified by Protein G affinity chromatography.
Form:
Supplied as a liquid in PBS, pH 7.2, 0.09% sodium azide. No stabilizing proteins added.
* VAT and and shipping costs not included. Errors and price changes excepted