Source: Recombinant Mouse from E. coli Accession No: P12025 Fragment: Ala22~Asp140 (Accession No: P12025) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-AKKKEKVKK GSECSEWTWG PCTPSSKDCG MGFREGTCGA QTQRVHCKVP CNWKKEFGAD CKYKFESWGA CDGSTGTKAR QGTLKKARYN AQCQETIRVT KPCTSKTKSK TKAKKGKGKD Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 18.8kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70C. Reconstitute with sterile sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Supplied as lyophilized powder from 100mM sodium bicarbonate, 500mM sodium chloride, pH 8.3, 1mM EDTA, 1mM DTT, 0.01% sarcosyl, 5% trehalose, 0.05% Proclin 300. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml. Do not vortex.
* VAT and and shipping costs not included. Errors and price changes excepted
