Aggrecan (AGC) Recombinant, Human

Catalog Number: USB-153398
Article Name: Aggrecan (AGC) Recombinant, Human
Biozol Catalog Number: USB-153398
Supplier Catalog Number: 153398
Alternative Catalog Number: USB-153398-10,USB-153398-50,USB-153398-200
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant Human from E. coli Accession No: P16112 Fragment: Pro34~Glu147 (Accession No: P16112) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-PQPSPLR VLLGTSLTIP CYFIDPMHPV TTAPSTAPLA PRIKWSRVSK EKEVVLLVAT EGRVRVNSAY QDKVSLPNYP AIPSDATLEV QSLRSNDSGV YRCEVMHGIE DSEATLE Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 18.2kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70C. Reconstitute with sterile 20mM Tris, 150mM sodium chloride, pH 8.0.. Aliquot to avoid repeated freezing and thawing. Store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Molecular Weight: 18.2
UniProt: P16112
Purity: 95%
Form: Supplied as lyophilized powder from 20mM Tris, 150mM sodium chloride, pH 8.0, 1mM EDTA, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile 20mM Tris, 150mM sodium chloride, pH 8.0 to a concentration of 0.1-1mg/ml. Do not v