USP45 (Ubiquitin-specific-processing Protease 45, Ubiquitin Carboxyl-terminal Hydrolase 45, Deubiquitinating Enzyme 45, Ubiquitin Thioesterase 45) (MaxLight 490), Clone: [1H2], Mouse, Monoclonal

Catalog Number: USB-135177-ML490
Article Name: USP45 (Ubiquitin-specific-processing Protease 45, Ubiquitin Carboxyl-terminal Hydrolase 45, Deubiquitinating Enzyme 45, Ubiquitin Thioesterase 45) (MaxLight 490), Clone: [1H2], Mouse, Monoclonal
Biozol Catalog Number: USB-135177-ML490
Supplier Catalog Number: 135177-ML490
Alternative Catalog Number: USB-135177-ML490-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IHC, WB
Immunogen: Partial recombinant corresponding to aa106-197 from human USP45 (XP_371838) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)490 is a new Blue-Green photostable dye conjugate comparable to DyLight(TM)488, Alexa Fluor(TM)488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm), Emission (515nm), Extinction Coefficient 73,000. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: FKSSRTEPHCIIINLSTWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQKGGKCRNLSVRGITNLG Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [1H2]
NCBI: 371838
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)490.