P2RX5 (P2X5, P2X Purinoceptor 5, ATP Receptor, Purinergic Receptor, MGC47755) (FITC), Clone: [1C5], Mouse, Monoclonal

Catalog Number: USB-130792-FITC
Article Name: P2RX5 (P2X5, P2X Purinoceptor 5, ATP Receptor, Purinergic Receptor, MGC47755) (FITC), Clone: [1C5], Mouse, Monoclonal
Biozol Catalog Number: USB-130792-FITC
Supplier Catalog Number: 130792-FITC
Alternative Catalog Number: USB-130792-FITC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant corresponding to aa126-225 from human P2RX5 (NP_002552) with GST tag. MW of the GST tag alone is 26kD.
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the purinoceptors family, this receptor has only a single transmembrane domain. Three transcript variants encoding distinct isoforms have been identified for this gene. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [1C5]
NCBI: 002561
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).