P15RS (RPRD1A, Regulation of Nuclear Pre-mRNA Domain-containing Protein 1A, Cyclin-dependent Kinase Inhibitor 2B-related Protein, p15INK4B-related Protein, FLJ10656, HsT3101, MGC19513) (MaxLight 550), Clone: [1B8], Mouse, Monoclon

Catalog Number: USB-130786-ML550
Article Name: P15RS (RPRD1A, Regulation of Nuclear Pre-mRNA Domain-containing Protein 1A, Cyclin-dependent Kinase Inhibitor 2B-related Protein, p15INK4B-related Protein, FLJ10656, HsT3101, MGC19513) (MaxLight 550), Clone: [1B8], Mouse, Monoclon
Biozol Catalog Number: USB-130786-ML550
Supplier Catalog Number: 130786-ML550
Alternative Catalog Number: USB-130786-ML550-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IHC, WB
Immunogen: Partial recombinant corresponding to aa76-171 from human P15RS (NP_060640) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor(TM)546, 555, DyLight(TM)549 , Cy3(TM), TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm), Emission (575nm), Extinction Coefficient 150,000. P15RS is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) (CDKN2B, MIM 600431) and may have a role in cell cycle regulation. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRAL Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [1B8]
NCBI: 018170
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)550.