OTX1 (Homeobox Protein OTX1, Orthodenticle Homolog 1, FLJ38361, MGC15736), Clone: [1F2], Mouse, Monoclonal

Catalog Number: USB-130774
Article Name: OTX1 (Homeobox Protein OTX1, Orthodenticle Homolog 1, FLJ38361, MGC15736), Clone: [1F2], Mouse, Monoclonal
Biozol Catalog Number: USB-130774
Supplier Catalog Number: 130774
Alternative Catalog Number: USB-130774-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IF, WB
Immunogen: Partial recombinant corresponding to aa10-117 from human OTX1 (NP_055377) with GST tag. MW of the GST tag alone is 26kD.
This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVR Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [1F2]
NCBI: 014562
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.