Osteoprotegerin (Tumor Necrosis Factor Receptor Superfamily Member 11B, Osteoclastogenesis Inhibitory Factor, TNFRSF11B, OCIF, OPG) (HRP), Rabbit
Catalog Number:
USB-130764-HRP
- Images (0)
| Article Name: | Osteoprotegerin (Tumor Necrosis Factor Receptor Superfamily Member 11B, Osteoclastogenesis Inhibitory Factor, TNFRSF11B, OCIF, OPG) (HRP), Rabbit |
| Biozol Catalog Number: | USB-130764-HRP |
| Supplier Catalog Number: | 130764-HRP |
| Alternative Catalog Number: | USB-130764-HRP-100 |
| Manufacturer: | US Biological |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Immunogen: | Full length human TNFRSF11B, aa1-401 (AAH30155.1). |
| Human OPG (Osteoprotegerin), also known as OCIF (Osteoclastogenesis inhibitory factor), is a member of the TNF receptor superfamily. It specifically acts on bone tissues and increases bone mineral density and bone volume associated with a decrease of active osteoclast number. Human OPG is a 20kD protein, comprising of 174aa residues. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody. |
Product Guarantee and Expert Support
